Lineage for d3zcda1 (3zcd A:1-294)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2010977Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [229469] (6 PDB entries)
  8. 2010980Domain d3zcda1: 3zcd A:1-294 [229470]
    Other proteins in same PDB: d3zcda2, d3zcdb2
    automated match to d3p8ra_

Details for d3zcda1

PDB Entry: 3zcd (more details), 1.55 Å

PDB Description: native structure of farnesyl pyrophosphate synthase from pseudomonas aeruginosa pa01.
PDB Compounds: (A:) Geranyltranstransferase

SCOPe Domain Sequences for d3zcda1:

Sequence, based on SEQRES records: (download)

>d3zcda1 a.128.1.0 (A:1-294) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
miaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealgg
apqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqala
fevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrhk
tgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvesdtatlgktqgk
dqahnkptypallgleaakgyalelrdlalaaldgfppsadplrqlaryiverr

Sequence, based on observed residues (ATOM records): (download)

>d3zcda1 a.128.1.0 (A:1-294) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
miaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealgg
apqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqala
fevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrhk
tgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvptypallgleaak
gyalelrdlalaaldgfppsadplrqlaryiverr

SCOPe Domain Coordinates for d3zcda1:

Click to download the PDB-style file with coordinates for d3zcda1.
(The format of our PDB-style files is described here.)

Timeline for d3zcda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zcda2