Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
Domain d4noba1: 4nob A:20-133 [229456] Other proteins in same PDB: d4noba2 automated match to d1zoxa_ complexed with edo, mg, nag |
PDB Entry: 4nob (more details), 1.51 Å
SCOPe Domain Sequences for d4noba1:
Sequence, based on SEQRES records: (download)
>d4noba1 b.1.1.0 (A:20-133) automated matches {Mouse (Mus musculus) [TaxId: 10090]} spifgpqevssiegdsvsitcyypdtsvnrhtrkywcrqgasgmcttlissngylskeys granlinfpenntfvinieqltqddtgsykcglgtsnrglsfdvslevsqvpel
>d4noba1 b.1.1.0 (A:20-133) automated matches {Mouse (Mus musculus) [TaxId: 10090]} spifgpqevssiegdsvsitcyypdtsvnrhtrkywcrqgasgmcttlissngylskeys granlinfpenntfvinieqltqddtgsykcglgtglsfdvslevsqvpel
Timeline for d4noba1: