Lineage for d4noba1 (4nob A:20-133)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759512Domain d4noba1: 4nob A:20-133 [229456]
    Other proteins in same PDB: d4noba2
    automated match to d1zoxa_
    complexed with edo, mg, nag

Details for d4noba1

PDB Entry: 4nob (more details), 1.51 Å

PDB Description: crystal structure of the 1st ig domain from mouse polymeric immunoglobulin receptor [psi-nysgrc-006220]
PDB Compounds: (A:) Polymeric immunoglobulin receptor

SCOPe Domain Sequences for d4noba1:

Sequence, based on SEQRES records: (download)

>d4noba1 b.1.1.0 (A:20-133) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spifgpqevssiegdsvsitcyypdtsvnrhtrkywcrqgasgmcttlissngylskeys
granlinfpenntfvinieqltqddtgsykcglgtsnrglsfdvslevsqvpel

Sequence, based on observed residues (ATOM records): (download)

>d4noba1 b.1.1.0 (A:20-133) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spifgpqevssiegdsvsitcyypdtsvnrhtrkywcrqgasgmcttlissngylskeys
granlinfpenntfvinieqltqddtgsykcglgtglsfdvslevsqvpel

SCOPe Domain Coordinates for d4noba1:

Click to download the PDB-style file with coordinates for d4noba1.
(The format of our PDB-style files is described here.)

Timeline for d4noba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4noba2