Lineage for d3azuc_ (3azu C:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Azurin [49530] (6 species) 
Species Pseudomonas aeruginosa [TaxId:287] [49533] (22 PDB entries) 
Domain d3azuc_: 3azu C: [22945]
Details for d3azuc_
PDB Entry: 3azu (more details), 2.1 Å
PDB Description: x-ray crystal structure of the two site-specific mutants his35gln and his35leu of azurin from pseudomonas aeruginosa
SCOP Domain Sequences for d3azuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3azuc_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa}
aqcsvdiqgndqmqfntnaitvdksckqftvnlsqpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk
SCOP Domain Coordinates for d3azuc_:
Click to download the PDB-style file with coordinates for d3azuc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3azuc_:
- d3azuc_ appears in SCOP 1.57
- d3azuc_ appears in the current release, SCOPe 2.08
View in 3D
