SCOPe 2.08: Domain d3azuc_: 3azu C:

Lineage for d3azuc_ (3azu C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
   Uniprot P00282

8. Domain d3azuc_: 3azu C: [22945]
   complexed with cu; mutant

Details for d3azuc_

PDB Entry: 3azu, 2.1 Å

PDB Description: x-ray crystal structure of the two site-specific mutants his35gln and his35leu of azurin from pseudomonas aeruginosa

PDB Compounds: (C:) Azurin

SCOPe Domain Sequences for d3azuc_:

Sequence; same for both SEQRES and ATOM records:

>d3azuc_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aqcsvdiqgndqmqfntnaitvdksckqftvnlsqpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

Timeline for d3azuc_:

• d3azuc_ first appeared (with stable ids) in SCOP 1.55
  
• d3azuc_ appears in SCOPe 2.07