SCOPe 2.05: Domain d4nmwa_: 4nmw A:

Lineage for d4nmwa_ (4nmw A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.26: Biotin biosynthesis protein BioH [82509] (2 proteins)
   automatically mapped to Pfam PF12697
   automatically mapped to Pfam PF00561

6. Protein automated matches [194519] (2 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [229444] (1 PDB entry)

8. Domain d4nmwa_: 4nmw A: [229445]
   automated match to d4etwa_
   complexed with cl, peg

Details for d4nmwa_

PDB Entry: 4nmw, 1.5 Å

PDB Description: Crystal Structure of Carboxylesterase BioH from Salmonella enterica

PDB Compounds: (A:) Pimelyl-[acyl-carrier protein] methyl ester esterase

SCOPe Domain Sequences for d4nmwa_:

Sequence; same for both SEQRES and ATOM records:

>d4nmwa_ c.69.1.26 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
diwwqtygegnchlvllhgwglnaevwhcireelgshftlhlvdlpgygrssgfgamtle
emtaqvaknapdqaiwlgwslgglvasqmalthpervqalvtvasspcfsaregwpgikp
eilggfqqqlsddfqrtverflalqtlgtetarqdartlksvvlaqpmpdvevlngglei
lktvdlrealknvnmpflrlygyldglvprkivplldtlwphstsqimakaahapfishp
aafcqalmtlkssl

Timeline for d4nmwa_:

• d4nmwa_ first appeared in SCOPe 2.03
  
• d4nmwa_ appears in SCOPe 2.04
  
• d4nmwa_ appears in SCOPe 2.06
  
• d4nmwa_ appears in the current release, SCOPe 2.08