Lineage for d4n1da_ (4n1d A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033672Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 3033789Protein automated matches [190307] (2 species)
    not a true protein
  7. 3033790Species Human (Homo sapiens) [TaxId:9606] [187121] (9 PDB entries)
  8. 3033791Domain d4n1da_: 4n1d A: [229441]
    automated match to d3bmpa_

Details for d4n1da_

PDB Entry: 4n1d (more details), 1.91 Å

PDB Description: nodal/bmp2 chimera nb250
PDB Compounds: (A:) Nodal/BMP2 chimera protein

SCOPe Domain Sequences for d4n1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n1da_ g.17.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kssckrhplyvdfnligwgswiiypkqynayrcegecpnpvgeefhptnhayiqsllkry
qphrvpstccvptelsaismlyldenekvvlknyqdmvvegcgcr

SCOPe Domain Coordinates for d4n1da_:

Click to download the PDB-style file with coordinates for d4n1da_.
(The format of our PDB-style files is described here.)

Timeline for d4n1da_: