Lineage for d4mgva_ (4mgv A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2185705Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2186026Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2186027Protein automated matches [191162] (27 species)
    not a true protein
  7. 2186135Species Plasmodium vivax [TaxId:5855] [189364] (5 PDB entries)
  8. 2186142Domain d4mgva_: 4mgv A: [229440]
    automated match to d3ihza_
    complexed with d5i

Details for d4mgva_

PDB Entry: 4mgv (more details), 1.72 Å

PDB Description: crystal structure of fk506 binding domain of plasmodium vivax fkbp35 in complex with inhibitor d5
PDB Compounds: (A:) 70 kDa peptidylprolyl isomerase, putative

SCOPe Domain Sequences for d4mgva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mgva_ d.26.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
tleqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrernvpf
kfhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeielisf
re

SCOPe Domain Coordinates for d4mgva_:

Click to download the PDB-style file with coordinates for d4mgva_.
(The format of our PDB-style files is described here.)

Timeline for d4mgva_: