Lineage for d3azub_ (3azu B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 10917Protein Azurin [49530] (6 species)
  7. 10946Species Pseudomonas aeruginosa [TaxId:287] [49533] (22 PDB entries)
  8. 10970Domain d3azub_: 3azu B: [22944]

Details for d3azub_

PDB Entry: 3azu (more details), 2.1 Å

PDB Description: x-ray crystal structure of the two site-specific mutants his35gln and his35leu of azurin from pseudomonas aeruginosa

SCOP Domain Sequences for d3azub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3azub_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa}
aqcsvdiqgndqmqfntnaitvdksckqftvnlsqpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOP Domain Coordinates for d3azub_:

Click to download the PDB-style file with coordinates for d3azub_.
(The format of our PDB-style files is described here.)

Timeline for d3azub_: