Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Synechocystis sp. PCC 6803 [TaxId:1148] [189864] (5 PDB entries) |
Domain d4mjea_: 4mje A: [229439] automated match to d3qmxa_ complexed with so4 |
PDB Entry: 4mje (more details), 1.2 Å
SCOPe Domain Sequences for d4mjea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mjea_ c.47.1.0 (A:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]} mrgshhhhhhgsavsakieiytwstcpfcmralallklkgvefqeycidgdneareamaa rangkrslpqifiddqhiggcddiyaldgagkldpllhs
Timeline for d4mjea_: