Lineage for d4mjea_ (4mje A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2135058Species Synechocystis sp. PCC 6803 [TaxId:1148] [189864] (5 PDB entries)
  8. 2135059Domain d4mjea_: 4mje A: [229439]
    automated match to d3qmxa_
    complexed with so4

Details for d4mjea_

PDB Entry: 4mje (more details), 1.2 Å

PDB Description: Synechocystis sp. PCC 6803 glutaredoxin A-R27L
PDB Compounds: (A:) Probable glutaredoxin ssr2061

SCOPe Domain Sequences for d4mjea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mjea_ c.47.1.0 (A:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
mrgshhhhhhgsavsakieiytwstcpfcmralallklkgvefqeycidgdneareamaa
rangkrslpqifiddqhiggcddiyaldgagkldpllhs

SCOPe Domain Coordinates for d4mjea_:

Click to download the PDB-style file with coordinates for d4mjea_.
(The format of our PDB-style files is described here.)

Timeline for d4mjea_: