SCOPe 2.08: Domain d4mbxf1: 4mbx F:29-298

Lineage for d4mbxf1 (4mbx F:29-298)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families)

5. Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)

6. Protein automated matches [191200] (13 species)
   not a true protein

7. Species Human polyomavirus 9 [TaxId:943908] [229433] (7 PDB entries)

8. Domain d4mbxf1: 4mbx F:29-298 [229436]
   Other proteins in same PDB: d4mbxa2, d4mbxb2, d4mbxc2, d4mbxd2, d4mbxe2, d4mbxf2, d4mbxg2, d4mbxh2, d4mbxi2, d4mbxj2
   automated match to d1vpsb_
   complexed with ca, edo

Details for d4mbxf1

PDB Entry: 4mbx, 1.92 Å

PDB Description: Structure of unliganded B-Lymphotropic Polyomavirus VP1

PDB Compounds: (F:) Major capsid protein VP1

SCOPe Domain Sequences for d4mbxf1:

Sequence; same for both SEQRES and ATOM records:

>d4mbxf1 b.121.6.1 (F:29-298) automated matches {Human polyomavirus 9 [TaxId: 943908]}
gvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdtlpcy
svaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvpvqgt
tyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgkypvev
wcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflscadia
gvhtnysetqvwrglpryfnvtlrkrivkn

Timeline for d4mbxf1:

• d4mbxf1 first appeared in SCOPe 2.03, called d4mbxf_
  
• d4mbxf1 was called d4mbxf_ in SCOPe 2.07