Lineage for d4i5be2 (4i5b E:93-191)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747484Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2747492Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 2747518Domain d4i5be2: 4i5b E:93-191 [229428]
    Other proteins in same PDB: d4i5ba1, d4i5ba2, d4i5bb1, d4i5bd1, d4i5bd2, d4i5be1
    automated match to d1sebb1

Details for d4i5be2

PDB Entry: 4i5b (more details), 2.12 Å

PDB Description: structure of human mhc class ii protein hla-dr1 carrying an influenza hemagglutinin peptide partially filling the binding groove
PDB Compounds: (E:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d4i5be2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i5be2 b.1.1.2 (E:93-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewrar

SCOPe Domain Coordinates for d4i5be2:

Click to download the PDB-style file with coordinates for d4i5be2.
(The format of our PDB-style files is described here.)

Timeline for d4i5be2: