SCOPe 2.08: Domain d4k9fa_: 4k9f A:

Lineage for d4k9fa_ (4k9f A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.1: Rubredoxin [57803] (5 proteins)

6. Protein Rubredoxin [57804] (8 species)

7. Species Pyrococcus furiosus [TaxId:2261] [57809] (30 PDB entries)
   Uniprot P24297

8. Domain d4k9fa_: 4k9f A: [229423]
   automated match to d1bq8a_
   complexed with dod, fe

Details for d4k9fa_

PDB Entry: 4k9f, 1.75 Å

PDB Description: neutron structure of perdeuterated rubredoxin refined against 1.75 resolution data collected on the new imagine instrument at hfir, ornl

PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d4k9fa_:

Sequence; same for both SEQRES and ATOM records:

>d4k9fa_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekle

Timeline for d4k9fa_:

• d4k9fa_ first appeared in SCOPe 2.03
  
• d4k9fa_ appears in SCOPe 2.07