SCOPe 2.08: Domain d4jhia1: 4jhi A:1-158

Lineage for d4jhia1 (4jhi A:1-158)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [194255] (8 PDB entries)

8. Domain d4jhia1: 4jhi A:1-158 [229422]
   Other proteins in same PDB: d4jhia2
   automated match to d4a85a_
   complexed with emu, na

Details for d4jhia1

PDB Entry: 4jhi, 2.6 Å

PDB Description: crystal structure of medicago truncatula nodulin 13 (mtn13) in complex with n6-benzyladenine

PDB Compounds: (A:) MtN13 protein

SCOPe Domain Sequences for d4jhia1:

Sequence; same for both SEQRES and ATOM records:

>d4jhia1 d.129.3.0 (A:1-158) automated matches {Medicago truncatula [TaxId: 3880]}
mgvitseseyvsslsaeklyrgivedgniiypkalprfiekaetlegdggpgtikkltfv
gdfgstkqhidmvdrencaytysvyegialsdqplekivfefklvptpeegcivksttky
ytkgddielskdyleagierfegftkavesfllanpdy

Timeline for d4jhia1:

• d4jhia1 first appeared in SCOPe 2.03, called d4jhia_
  
• d4jhia1 appears in SCOPe 2.07