SCOPe 2.06: Domain d4jhha1: 4jhh A:1-158

Lineage for d4jhha1 (4jhh A:1-158)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (22 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [194255] (7 PDB entries)

8. Domain d4jhha1: 4jhh A:1-158 [229421]
   Other proteins in same PDB: d4jhha2
   automated match to d4jhga_
   complexed with h35, mli, na

Details for d4jhha1

PDB Entry: 4jhh, 2.2 Å

PDB Description: Crystal Structure of Medicago truncatula Nodulin 13 (MtN13) in complex with kinetin

PDB Compounds: (A:) MtN13 protein

SCOPe Domain Sequences for d4jhha1:

Sequence; same for both SEQRES and ATOM records:

>d4jhha1 d.129.3.0 (A:1-158) automated matches {Medicago truncatula [TaxId: 3880]}
mgvitseseyvsslsaeklyrgivedgniiypkalprfiekaetlegdggpgtikkltfv
gdfgstkqhidmvdrencaytysvyegialsdqplekivfefklvptpeegcivksttky
ytkgddielskdyleagierfegftkavesfllanpdy

Timeline for d4jhha1:

• d4jhha1 first appeared in SCOPe 2.03, called d4jhha_
  
• d4jhha1 was called d4jhha_ in SCOPe 2.05
  
• d4jhha1 appears in SCOPe 2.07
  
• d4jhha1 appears in the current release, SCOPe 2.08