SCOPe 2.05: Domain d4il5b_: 4il5 B:

Lineage for d4il5b_ (4il5 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.0: automated matches [191338] (1 protein)
   not a true family

6. Protein automated matches [190215] (23 species)
   not a true protein

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [229402] (1 PDB entry)

8. Domain d4il5b_: 4il5 B: [229403]
   automated match to d3bm5a_
   complexed with ile, so4

Details for d4il5b_

PDB Entry: 4il5, 2.03 Å

PDB Description: Crystal structure of O-Acetyl Serine Sulfhydrylase from Entamoeba histolytica in complex with isoleucine

PDB Compounds: (B:) Cysteine synthase

SCOPe Domain Sequences for d4il5b_:

Sequence; same for both SEQRES and ATOM records:

>d4il5b_ c.79.1.0 (B:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
eqisissprkriyhniletiggtplvelhgvtehprikkgtrilvkleyfnpmssvkdrv
gfnivyqaikdgrlkpgmeiiestsgntgialcqagavfgyrvniampstmsverqmimk
afgaeliltegkkgmpgaieevnkmikenpgkyfvanqfgnpdntaahhytaneiwedtd
gevdivvsavgtsgtvigvaeklkekkkgikiiavepeesavlegkakgphgiqgigagf
ipdiykkefvdeiipiktqdawkmaravvkydgimcgmssgaailaglkeaekpenegkt
iviivpscgerylstdlykikdegtkiqildsll

Timeline for d4il5b_:

• d4il5b_ first appeared in SCOPe 2.03
  
• d4il5b_ appears in SCOPe 2.04
  
• d4il5b_ appears in SCOPe 2.06
  
• d4il5b_ appears in the current release, SCOPe 2.08