Lineage for d4il5b_ (4il5 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2140097Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [229402] (1 PDB entry)
  8. 2140098Domain d4il5b_: 4il5 B: [229403]
    automated match to d3bm5a_
    complexed with ile, so4

Details for d4il5b_

PDB Entry: 4il5 (more details), 2.03 Å

PDB Description: Crystal structure of O-Acetyl Serine Sulfhydrylase from Entamoeba histolytica in complex with isoleucine
PDB Compounds: (B:) Cysteine synthase

SCOPe Domain Sequences for d4il5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il5b_ c.79.1.0 (B:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
eqisissprkriyhniletiggtplvelhgvtehprikkgtrilvkleyfnpmssvkdrv
gfnivyqaikdgrlkpgmeiiestsgntgialcqagavfgyrvniampstmsverqmimk
afgaeliltegkkgmpgaieevnkmikenpgkyfvanqfgnpdntaahhytaneiwedtd
gevdivvsavgtsgtvigvaeklkekkkgikiiavepeesavlegkakgphgiqgigagf
ipdiykkefvdeiipiktqdawkmaravvkydgimcgmssgaailaglkeaekpenegkt
iviivpscgerylstdlykikdegtkiqildsll

SCOPe Domain Coordinates for d4il5b_:

Click to download the PDB-style file with coordinates for d4il5b_.
(The format of our PDB-style files is described here.)

Timeline for d4il5b_: