![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
![]() | Protein automated matches [190215] (38 species) not a true protein |
![]() | Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [229402] (2 PDB entries) |
![]() | Domain d4il5b_: 4il5 B: [229403] automated match to d3bm5a_ complexed with ile, so4 |
PDB Entry: 4il5 (more details), 2.03 Å
SCOPe Domain Sequences for d4il5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4il5b_ c.79.1.0 (B:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} eqisissprkriyhniletiggtplvelhgvtehprikkgtrilvkleyfnpmssvkdrv gfnivyqaikdgrlkpgmeiiestsgntgialcqagavfgyrvniampstmsverqmimk afgaeliltegkkgmpgaieevnkmikenpgkyfvanqfgnpdntaahhytaneiwedtd gevdivvsavgtsgtvigvaeklkekkkgikiiavepeesavlegkakgphgiqgigagf ipdiykkefvdeiipiktqdawkmaravvkydgimcgmssgaailaglkeaekpenegkt iviivpscgerylstdlykikdegtkiqildsll
Timeline for d4il5b_: