SCOPe 2.05: Domain d4i7vd_: 4i7v D:

Lineage for d4i7vd_ (4i7v D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (63 species)
   not a true protein

7. Species Agrobacterium sp. [TaxId:861208] [229400] (3 PDB entries)

8. Domain d4i7vd_: 4i7v D: [229401]
   automated match to d3pb2b_

Details for d4i7vd_

PDB Entry: 4i7v, 1.45 Å

PDB Description: Agrobacterium tumefaciens DHDPS with pyruvate

PDB Compounds: (D:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d4i7vd_:

Sequence; same for both SEQRES and ATOM records:

>d4i7vd_ c.1.10.0 (D:) automated matches {Agrobacterium sp. [TaxId: 861208]}
mfkgsipalitpftdngavdeqafaahvewqiaegsnglvpvgttgesptlshdehkrvv
elcievaakrvpviagagsnntdeaielalhaqdagadallvvtpyynkptqkglfahfs
avaeavklpiviynipprsvvdmspetmgalvkahknivgvxdatgkldrvseqriscgk
dfiqlsgedstalgfnahggvgcisvsanvaprlcsefqaamlagdyakaleyqdrlmpl
hraifmepgvcgtkyalsktrgcnrkvrsplmstlepateaaidaalkhaglmn

Timeline for d4i7vd_:

• d4i7vd_ first appeared in SCOPe 2.03
  
• d4i7vd_ appears in SCOPe 2.04
  
• d4i7vd_ appears in SCOPe 2.06
  
• d4i7vd_ appears in the current release, SCOPe 2.08