Lineage for d1e5za_ (1e5z A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106630Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 106648Protein Azurin [49530] (6 species)
  7. 106677Species Pseudomonas aeruginosa [TaxId:287] [49533] (31 PDB entries)
  8. 106701Domain d1e5za_: 1e5z A: [22939]

Details for d1e5za_

PDB Entry: 1e5z (more details), 2 Å

PDB Description: azurin from pseudomonas aeruginosa, reduced form, ph 9.0

SCOP Domain Sequences for d1e5za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5za_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOP Domain Coordinates for d1e5za_:

Click to download the PDB-style file with coordinates for d1e5za_.
(The format of our PDB-style files is described here.)

Timeline for d1e5za_: