Class a: All alpha proteins [46456] (285 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (40 species) not a true protein |
Species Novosphingobium aromaticivorans [TaxId:279238] [189372] (11 PDB entries) |
Domain d4c9lb_: 4c9l B: [229383] automated match to d3lxia_ complexed with cam, cyn, hem |
PDB Entry: 4c9l (more details), 1.8 Å
SCOPe Domain Sequences for d4c9lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c9lb_ a.104.1.0 (B:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]} khrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatrg tlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkle dqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrps gntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralglv sllllggldtvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryvv sdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmhl arlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq
Timeline for d4c9lb_: