Lineage for d3zc5a_ (3zc5 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (20 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (770 PDB entries)
  8. 2545643Domain d3zc5a_: 3zc5 A: [229381]
    automated match to d4ap7a_
    complexed with w9z

Details for d3zc5a_

PDB Entry: 3zc5 (more details), 2.2 Å

PDB Description: x-ray structure of c-met kinase in complex with inhibitor (s)-6-(1-(6- (1-methyl-1h-pyrazol-4-yl)-(1,2,4)triazolo(4,3-b)pyridazin-3-yl) ethyl) quinoline.
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d3zc5a_:

Sequence, based on SEQRES records: (download)

>d3zc5a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavks
lnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirn
ethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmyd
keyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfd
itvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi

Sequence, based on observed residues (ATOM records): (download)

>d3zc5a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkkihcavkslnri
tdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethn
ptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyy
svhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvy
llqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi

SCOPe Domain Coordinates for d3zc5a_:

Click to download the PDB-style file with coordinates for d3zc5a_.
(The format of our PDB-style files is described here.)

Timeline for d3zc5a_: