Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (64 species) not a true protein |
Species Novosphingobium aromaticivorans [TaxId:48935] [229374] (3 PDB entries) |
Domain d4c9pa_: 4c9p A: [229375] automated match to d3lxia_ complexed with cam, gol, hem; mutant |
PDB Entry: 4c9p (more details), 1.8 Å
SCOPe Domain Sequences for d4c9pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c9pa_ a.104.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]} qkhrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatr gtlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkl edqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrp sgntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralgl vsllllggldavvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryv vsdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmh larlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq
Timeline for d4c9pa_: