Lineage for d4c9pa_ (4c9p A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005796Species Novosphingobium aromaticivorans [TaxId:48935] [229374] (3 PDB entries)
  8. 2005797Domain d4c9pa_: 4c9p A: [229375]
    automated match to d3lxia_
    complexed with cam, gol, hem; mutant

Details for d4c9pa_

PDB Entry: 4c9p (more details), 1.8 Å

PDB Description: Structure of camphor bound T260A mutant of CYP101D1
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d4c9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c9pa_ a.104.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
qkhrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatr
gtlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkl
edqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrp
sgntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralgl
vsllllggldavvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryv
vsdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmh
larlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq

SCOPe Domain Coordinates for d4c9pa_:

Click to download the PDB-style file with coordinates for d4c9pa_.
(The format of our PDB-style files is described here.)

Timeline for d4c9pa_: