Lineage for d4c9mb_ (4c9m B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278159Species Novosphingobium aromaticivorans [TaxId:279238] [189372] (9 PDB entries)
  8. 1278166Domain d4c9mb_: 4c9m B: [229373]
    automated match to d3lxia_
    complexed with gol, hem

Details for d4c9mb_

PDB Entry: 4c9m (more details), 1.8 Å

PDB Description: Structure of substrate free, glycerol bound wild type CYP101D1
PDB Compounds: (B:) cytochrome p450

SCOPe Domain Sequences for d4c9mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c9mb_ a.104.1.0 (B:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
khrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatrg
tlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkle
dqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrps
gntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralglv
sllllggldtvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryvv
sdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmhl
arlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq

SCOPe Domain Coordinates for d4c9mb_:

Click to download the PDB-style file with coordinates for d4c9mb_.
(The format of our PDB-style files is described here.)

Timeline for d4c9mb_: