SCOPe 2.03: Domain d4biic_: 4bii C:

Lineage for d4biic_ (4bii C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Enoyl-ACP reductase [51791] (11 species)

7. Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (44 PDB entries)

8. Domain d4biic_: 4bii C: [229369]
   automated match to d1p44a_
   complexed with nad, pyw

Details for d4biic_

PDB Entry: 4bii, 1.95 Å

PDB Description: How nature bridges the gap: Crystallographic elucidation of pyridomycin binding to InhA

PDB Compounds: (C:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d4biic_:

Sequence, based on SEQRES records:

>d4biic_ c.2.1.2 (C:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

Sequence, based on observed residues (ATOM records):

>d4biic_ c.2.1.2 (C:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpiriqlleegwdqrapigwnmkdatpvaktvcallsdwlpattgdiiya
dggahtqll

Timeline for d4biic_:

• d4biic_ is new in SCOPe 2.03-stable
  
• d4biic_ appears in SCOPe 2.04
  
• d4biic_ appears in the current release, SCOPe 2.08