SCOPe 2.03: Domain d3znke_: 3znk E:

Lineage for d3znke_ (3znk E:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (11 species)
   not a true protein

7. Species Influenza virus [TaxId:644788] [193029] (6 PDB entries)

8. Domain d3znke_: 3znk E: [229360]
   automated match to d4bgxa_
   complexed with epe, nag

Details for d3znke_

PDB Entry: 3znk, 2.71 Å

PDB Description: h5 haemagglutinin in complex with 6-o-sulfo-2,3-sialyllactosamine (sulfated 3'sln)

PDB Compounds: (E:) Haemagglutinin

SCOPe Domain Sequences for d3znke_:

Sequence; same for both SEQRES and ATOM records:

>d3znke_ b.19.1.2 (E:) automated matches {Influenza virus [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

Timeline for d3znke_:

• d3znke_ is new in SCOPe 2.03-stable
  
• d3znke_ appears in SCOPe 2.04
  
• d3znke_ appears in the current release, SCOPe 2.08