SCOPe 2.05: Domain d3znma_: 3znm A:

Lineage for d3znma_ (3znm A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza virus [TaxId:644788] [193029] (6 PDB entries)

8. Domain d3znma_: 3znm A: [229354]
   Other proteins in same PDB: d3znmb_, d3znmd_, d3znmf_
   automated match to d4bgxa_
   complexed with epe, nag

Details for d3znma_

PDB Entry: 3znm, 2.4 Å

PDB Description: h5 haemagglutinin in complex with sialyl-lewis x

PDB Compounds: (A:) Haemagglutinin

SCOPe Domain Sequences for d3znma_:

Sequence; same for both SEQRES and ATOM records:

>d3znma_ b.19.1.2 (A:) automated matches {Influenza virus [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

Timeline for d3znma_:

• d3znma_ first appeared in SCOPe 2.03
  
• d3znma_ appears in SCOPe 2.04
  
• d3znma_ appears in SCOPe 2.06
  
• d3znma_ appears in the current release, SCOPe 2.08