Lineage for d3znlc_ (3znl C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531574Protein automated matches [190291] (23 species)
    not a true protein
  7. 1531689Species Influenza virus [TaxId:644788] [193029] (6 PDB entries)
  8. 1531697Domain d3znlc_: 3znl C: [229353]
    Other proteins in same PDB: d3znlb_, d3znld_, d3znlf_
    automated match to d4bgxa_
    complexed with epe, nag

Details for d3znlc_

PDB Entry: 3znl (more details), 2.5 Å

PDB Description: h5 haemagglutinin in complex with 6-o-sulfo-sialyl-lewis x (sulfated lewis x)
PDB Compounds: (C:) Haemagglutinin

SCOPe Domain Sequences for d3znlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3znlc_ b.19.1.2 (C:) automated matches {Influenza virus [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d3znlc_:

Click to download the PDB-style file with coordinates for d3znlc_.
(The format of our PDB-style files is described here.)

Timeline for d3znlc_: