Lineage for d3znme_ (3znm E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1306050Protein automated matches [190291] (11 species)
    not a true protein
  7. 1306122Species Influenza virus [TaxId:644788] [193029] (6 PDB entries)
  8. 1306128Domain d3znme_: 3znm E: [229352]
    automated match to d4bgxa_
    complexed with epe, nag

Details for d3znme_

PDB Entry: 3znm (more details), 2.4 Å

PDB Description: h5 haemagglutinin in complex with sialyl-lewis x
PDB Compounds: (E:) Haemagglutinin

SCOPe Domain Sequences for d3znme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3znme_ b.19.1.2 (E:) automated matches {Influenza virus [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d3znme_:

Click to download the PDB-style file with coordinates for d3znme_.
(The format of our PDB-style files is described here.)

Timeline for d3znme_: