Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (24 species) not a true protein |
Species Influenza virus [TaxId:644788] [193029] (6 PDB entries) |
Domain d3znla_: 3znl A: [229351] Other proteins in same PDB: d3znlb_, d3znld_, d3znlf_ automated match to d4bgxa_ complexed with epe, nag |
PDB Entry: 3znl (more details), 2.5 Å
SCOPe Domain Sequences for d3znla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3znla_ b.19.1.2 (A:) automated matches {Influenza virus [TaxId: 644788]} dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlatglrnsp
Timeline for d3znla_: