SCOPe 2.08: Domain d3wg3a1: 3wg3 A:0-160

Lineage for d3wg3a1 (3wg3 A:0-160)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Agrocybe cylindracea [TaxId:64608] [225007] (7 PDB entries)

8. Domain d3wg3a1: 3wg3 A:0-160 [229348]
   Other proteins in same PDB: d3wg3a2, d3wg3a3, d3wg3b2
   automated match to d1ww4a_
   complexed with edo, peg

Details for d3wg3a1

PDB Entry: 3wg3, 1.35 Å

PDB Description: crystal structure of agrocybe cylindracea galectin with blood type a antigen tetraose

PDB Compounds: (A:) Galactoside-binding lectin

SCOPe Domain Sequences for d3wg3a1:

Sequence; same for both SEQRES and ATOM records:

>d3wg3a1 b.29.1.0 (A:0-160) automated matches {Agrocybe cylindracea [TaxId: 64608]}
hmttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengay
llhiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvin
ektviqytkqisgttsslsynstegtsifstvveavtytgl

Timeline for d3wg3a1:

• d3wg3a1 first appeared in SCOPe 2.03, called d3wg3a_
  
• d3wg3a1 appears in SCOPe 2.07