Lineage for d4nekd_ (4nek D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853850Species Magnetospirillum magneticum [TaxId:342108] [226647] (2 PDB entries)
  8. 2853855Domain d4nekd_: 4nek D: [229342]
    automated match to d2ej5a_
    complexed with peg

Details for d4nekd_

PDB Entry: 4nek (more details), 2.3 Å

PDB Description: putative enoyl-coa hydratase/carnithine racemase from magnetospirillum magneticum amb-1
PDB Compounds: (D:) Enoyl-CoA hydratase/carnithine racemase

SCOPe Domain Sequences for d4nekd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nekd_ c.14.1.0 (D:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}
selvlshveggvqvvrmnrpdkknaligemyaalaeafakgeadddvnvflilgsqtdfs
agndlpdfltwealsgsvadrfiravagarkpvvaavrgaaigigstllphcdlvyaapg
trfhmpfinlgivpeagssqtmpalaghrraaemlmlgepfgvdtaeavglingvvpged
leetamaaarklaakprsilvqikalmktpaepimdrltreaavfdtclkgealneavsa
fkekrapdfsk

SCOPe Domain Coordinates for d4nekd_:

Click to download the PDB-style file with coordinates for d4nekd_.
(The format of our PDB-style files is described here.)

Timeline for d4nekd_: