Lineage for d4myna_ (4myn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115323Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 protein domains)
    Pfam PF00491
  6. 2115567Protein automated matches [190112] (3 species)
    not a true protein
  7. 2115592Species Trypanosoma cruzi [TaxId:469008] [229339] (1 PDB entry)
  8. 2115593Domain d4myna_: 4myn A: [229340]
    automated match to d2a0ma1
    complexed with mn

Details for d4myna_

PDB Entry: 4myn (more details), 1.8 Å

PDB Description: Crystal structure of Trypanosoma cruzi formiminoglutamase N114H variant with Mn2+2
PDB Compounds: (A:) Formiminoglutamase

SCOPe Domain Sequences for d4myna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4myna_ c.42.1.1 (A:) automated matches {Trypanosoma cruzi [TaxId: 469008]}
tddprllslfsaqreedadiviigfpydegcvrnggragakkgpaafrfflqrlgsvnnl
elnvdashlklydagditastleeahekleskvftvlargafpfviggghdqsapngram
lrafpgdvgvinvdshldvrpplsdgrvhsgtpfrqlleessfsgkrfvefacqgsqcga
lhaqyvrdhqghlmwlsevrkkgavaaledafgltgkntffsfdvdslkssdmpgvscpa
avglsaqeafdmcflagktptvmmmdmselnplveeyrsprvavymfyhfvlgfatrp

SCOPe Domain Coordinates for d4myna_:

Click to download the PDB-style file with coordinates for d4myna_.
(The format of our PDB-style files is described here.)

Timeline for d4myna_: