Lineage for d4mxra_ (4mxr A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850944Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 1850945Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 1850946Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 1851190Protein automated matches [190112] (3 species)
    not a true protein
  7. 1851217Species Trypanosoma cruzi [TaxId:5693] [229336] (4 PDB entries)
  8. 1851221Domain d4mxra_: 4mxr A: [229338]
    automated match to d2a0ma1
    complexed with gol, mn

Details for d4mxra_

PDB Entry: 4mxr (more details), 1.85 Å

PDB Description: Crystal structure of Trypanosoma cruzi formiminoglutamase with Mn2+2
PDB Compounds: (A:) Formiminoglutamase

SCOPe Domain Sequences for d4mxra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mxra_ c.42.1.1 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ddprllslfsaqreedadiviigfpydegcvrnggragakkgpaafrfflqrlgsvnnle
lnvdashlklydagditastleeahekleskvftvlargafpfvigggndqsapngraml
rafpgdvgvinvdshldvrpplsdgrvhsgtpfrqlleessfsgkrfvefacqgsqcgal
haqyvrdhqghlmwlsevrkkgavaaledafgltgkntffsfdvdslkssdmpgvscpaa
vglsaqeafdmcflagktptvmmmdmselnplveeyrsprvavymfyhfvlgfatrp

SCOPe Domain Coordinates for d4mxra_:

Click to download the PDB-style file with coordinates for d4mxra_.
(The format of our PDB-style files is described here.)

Timeline for d4mxra_: