| Class b: All beta proteins [48724] (180 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
| Protein automated matches [190873] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries) |
| Domain d4msva_: 4msv A: [229327] automated match to d1tnra_ complexed with gol, mg |
PDB Entry: 4msv (more details), 2.5 Å
SCOPe Domain Sequences for d4msva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4msva_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrkvahltgksnsrsmplewedtygivllsgvkykkgglvinetglyfvyskvyfrgqsc
nnlplshkvymrnskypqdlvmmegkmmsycttgqmwarssylgavfnltsadhlyvnvs
elslvnfeesqtffglykl
Timeline for d4msva_: