Lineage for d4msva_ (4msv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777600Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2777654Domain d4msva_: 4msv A: [229327]
    automated match to d1tnra_
    complexed with gol, mg

Details for d4msva_

PDB Entry: 4msv (more details), 2.5 Å

PDB Description: crystal structure of fasl and dcr3 complex
PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 6

SCOPe Domain Sequences for d4msva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4msva_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrkvahltgksnsrsmplewedtygivllsgvkykkgglvinetglyfvyskvyfrgqsc
nnlplshkvymrnskypqdlvmmegkmmsycttgqmwarssylgavfnltsadhlyvnvs
elslvnfeesqtffglykl

SCOPe Domain Coordinates for d4msva_:

Click to download the PDB-style file with coordinates for d4msva_.
(The format of our PDB-style files is described here.)

Timeline for d4msva_: