![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [228101] (5 PDB entries) |
![]() | Domain d4maza2: 4maz A:483-561 [229324] Other proteins in same PDB: d4maza1 automated match to d1uoka1 complexed with gol, mg, trs; mutant |
PDB Entry: 4maz (more details), 1.6 Å
SCOPe Domain Sequences for d4maza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4maza2 b.71.1.0 (A:483-561) automated matches {Bacillus subtilis [TaxId: 224308]} gdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqer adlksislkpyeavmgisi
Timeline for d4maza2: