SCOPe 2.07: Domain d4maza2: 4maz A:483-561

Lineage for d4maza2 (4maz A:483-561)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (35 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [228101] (5 PDB entries)

8. Domain d4maza2: 4maz A:483-561 [229324]
   Other proteins in same PDB: d4maza1
   automated match to d1uoka1
   complexed with gol, mg, trs; mutant

Details for d4maza2

PDB Entry: 4maz, 1.6 Å

PDB Description: The Structure of MalL mutant enzyme V200S from Bacillus subtilus

PDB Compounds: (A:) Oligo-1,6-glucosidase 1

SCOPe Domain Sequences for d4maza2:

Sequence; same for both SEQRES and ATOM records:

>d4maza2 b.71.1.0 (A:483-561) automated matches {Bacillus subtilis [TaxId: 224308]}
gdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqer
adlksislkpyeavmgisi

Timeline for d4maza2:

• d4maza2 first appeared in SCOPe 2.03
  
• d4maza2 appears in SCOPe 2.06