Lineage for d4maza2 (4maz A:483-561)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811003Species Bacillus subtilis [TaxId:224308] [228101] (5 PDB entries)
  8. 2811006Domain d4maza2: 4maz A:483-561 [229324]
    Other proteins in same PDB: d4maza1
    automated match to d1uoka1
    complexed with gol, mg, trs; mutant

Details for d4maza2

PDB Entry: 4maz (more details), 1.6 Å

PDB Description: The Structure of MalL mutant enzyme V200S from Bacillus subtilus
PDB Compounds: (A:) Oligo-1,6-glucosidase 1

SCOPe Domain Sequences for d4maza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4maza2 b.71.1.0 (A:483-561) automated matches {Bacillus subtilis [TaxId: 224308]}
gdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqer
adlksislkpyeavmgisi

SCOPe Domain Coordinates for d4maza2:

Click to download the PDB-style file with coordinates for d4maza2.
(The format of our PDB-style files is described here.)

Timeline for d4maza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4maza1