SCOPe 2.03: Domain d4m9wb_: 4m9w B:

Lineage for d4m9wb_ (4m9w B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (13 species)
   not a true protein

7. Species Arachis hypogaea [TaxId:3818] [229316] (4 PDB entries)

8. Domain d4m9wb_: 4m9w B: [229318]
   automated match to d4a85a_
   complexed with mes, na

Details for d4m9wb_

PDB Entry: 4m9w, 1.95 Å

PDB Description: Crystal Structure of Ara h 8 with MES bound

PDB Compounds: (B:) Ara h 8 allergen

SCOPe Domain Sequences for d4m9wb_:

Sequence; same for both SEQRES and ATOM records:

>d4m9wb_ d.129.3.0 (B:) automated matches {Arachis hypogaea [TaxId: 3818]}
gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
kgdakpdeeelkkgkakgeglfraiegyvlanptqy

Timeline for d4m9wb_:

• d4m9wb_ is new in SCOPe 2.03-stable
  
• d4m9wb_ appears in SCOPe 2.04
  
• d4m9wb_ appears in the current release, SCOPe 2.08