Lineage for d1e65a_ (1e65 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774128Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1774206Protein Azurin [49530] (6 species)
  7. 1774237Species Pseudomonas aeruginosa [TaxId:287] [49533] (87 PDB entries)
    Uniprot P00282
  8. 1774346Domain d1e65a_: 1e65 A: [22931]

Details for d1e65a_

PDB Entry: 1e65 (more details), 1.85 Å

PDB Description: azurin from pseudomonas aeruginosa, apo form
PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d1e65a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e65a_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOPe Domain Coordinates for d1e65a_:

Click to download the PDB-style file with coordinates for d1e65a_.
(The format of our PDB-style files is described here.)

Timeline for d1e65a_: