![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
![]() | Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) ![]() |
![]() | Family c.121.1.0: automated matches [191649] (1 protein) not a true family |
![]() | Protein automated matches [191196] (7 species) not a true protein |
![]() | Species Lactobacillus rhamnosus [TaxId:568704] [229308] (4 PDB entries) |
![]() | Domain d4lfmd_: 4lfm D: [229309] automated match to d3he8b_ complexed with psj |
PDB Entry: 4lfm (more details), 1.65 Å
SCOPe Domain Sequences for d4lfmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lfmd_ c.121.1.0 (D:) automated matches {Lactobacillus rhamnosus [TaxId: 568704]} miiaigndhivtmqkieisnmlkdmgytvidegtydthrthypiygkkvaedvadgradl givmcgtgigistaadknegiraamcddvtsavyareqlnanvlgiggavvgvhliqdiv kayldatyketpenkklidkidniakpnpdqkdnphffdaelekwaegvyhd
Timeline for d4lfmd_: