Lineage for d4lfmd_ (4lfm D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921985Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2921986Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2922038Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2922039Protein automated matches [191196] (11 species)
    not a true protein
  7. 2922061Species Lactobacillus rhamnosus [TaxId:568704] [229308] (4 PDB entries)
  8. 2922069Domain d4lfmd_: 4lfm D: [229309]
    automated match to d3he8b_
    complexed with psj

Details for d4lfmd_

PDB Entry: 4lfm (more details), 1.65 Å

PDB Description: Crystal Structure of D-galactose-6-phosphate isomerase in complex with D-psicose
PDB Compounds: (D:) Galactose-6-phosphate isomerase subunit B

SCOPe Domain Sequences for d4lfmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lfmd_ c.121.1.0 (D:) automated matches {Lactobacillus rhamnosus [TaxId: 568704]}
miiaigndhivtmqkieisnmlkdmgytvidegtydthrthypiygkkvaedvadgradl
givmcgtgigistaadknegiraamcddvtsavyareqlnanvlgiggavvgvhliqdiv
kayldatyketpenkklidkidniakpnpdqkdnphffdaelekwaegvyhd

SCOPe Domain Coordinates for d4lfmd_:

Click to download the PDB-style file with coordinates for d4lfmd_.
(The format of our PDB-style files is described here.)

Timeline for d4lfmd_: