Lineage for d4l40a_ (4l40 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005692Species Jeotgalicoccus sp. [TaxId:946435] [229305] (5 PDB entries)
  8. 2005694Domain d4l40a_: 4l40 A: [229306]
    automated match to d1izoa_
    complexed with dcr, hem

Details for d4l40a_

PDB Entry: 4l40 (more details), 2.5 Å

PDB Description: Structure of the P450 OleT with a C20 fatty acid substrate bound
PDB Compounds: (A:) Terminal olefin-forming fatty acid decarboxylase

SCOPe Domain Sequences for d4l40a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l40a_ a.104.1.0 (A:) automated matches {Jeotgalicoccus sp. [TaxId: 946435]}
lkrdkgldntlkvlkqgylyttnqrnrlntsvfqtkalggkpfvvvtgkegaemfynndv
vqregmlpkrivntlfgkgaihtvdgkkhvdrkalfmslmtegnlnyvreltrtlwhant
qrmesmdevniyresivlltkvgtrwagvqappedieriatdmdimidsfralggafkgy
kaskearrrvedwleeqiietrkgnihppegtalyefahwedylgnpmdsrtcaidlmnt
frpliainrfvsfglhamnenpitrekiksepdyaykfaqevrryypfvpflpgkakvdi
dfqgvtipagvglaldvygtthdeslwddpnefrperfetwdgspfdlipqgggdywtnh
rcagewitviimeetmkyfaekitydvpeqdlevdlnsipgyvksgfviknvrevvdrt

SCOPe Domain Coordinates for d4l40a_:

Click to download the PDB-style file with coordinates for d4l40a_.
(The format of our PDB-style files is described here.)

Timeline for d4l40a_: