![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Jeotgalicoccus sp. [TaxId:946435] [229305] (5 PDB entries) |
![]() | Domain d4l40a_: 4l40 A: [229306] automated match to d1izoa_ complexed with dcr, hem |
PDB Entry: 4l40 (more details), 2.5 Å
SCOPe Domain Sequences for d4l40a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l40a_ a.104.1.0 (A:) automated matches {Jeotgalicoccus sp. [TaxId: 946435]} lkrdkgldntlkvlkqgylyttnqrnrlntsvfqtkalggkpfvvvtgkegaemfynndv vqregmlpkrivntlfgkgaihtvdgkkhvdrkalfmslmtegnlnyvreltrtlwhant qrmesmdevniyresivlltkvgtrwagvqappedieriatdmdimidsfralggafkgy kaskearrrvedwleeqiietrkgnihppegtalyefahwedylgnpmdsrtcaidlmnt frpliainrfvsfglhamnenpitrekiksepdyaykfaqevrryypfvpflpgkakvdi dfqgvtipagvglaldvygtthdeslwddpnefrperfetwdgspfdlipqgggdywtnh rcagewitviimeetmkyfaekitydvpeqdlevdlnsipgyvksgfviknvrevvdrt
Timeline for d4l40a_: