Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (6 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (99 PDB entries) |
Domain d4kthe_: 4kth E: [229304] Other proteins in same PDB: d4kthb_, d4kthd_, d4kthf_ automated match to d1rvxa_ complexed with nag |
PDB Entry: 4kth (more details), 2.6 Å
SCOPe Domain Sequences for d4kthe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kthe_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} gdhicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvag wllgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqiipk nswsdheaslgvsaacpyqgkssffrnvvwlikkdnayptikkgynntnqedllvlwgih hpndeaeqtrlyqnpttyisigtstlnqrlvpkiatrskingqsgridffwtilkpndai hfesngnfiapeyaykivkkgdstimkseveygncntrcqtpigainssmpfhnihplti gecpkyvksnklvlatglrns
Timeline for d4kthe_: