Lineage for d4kh0b2 (4kh0 B:101-153)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464408Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 1464409Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 1464410Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 1464411Species Escherichia coli [TaxId:562] [57828] (59 PDB entries)
    Uniprot P00478
  8. 1464444Domain d4kh0b2: 4kh0 B:101-153 [229303]
    Other proteins in same PDB: d4kh0a1, d4kh0a2, d4kh0b1, d4kh0c1, d4kh0c2, d4kh0d1
    automated match to d2fzcb2
    complexed with atp, mg, pal, zn

Details for d4kh0b2

PDB Entry: 4kh0 (more details), 2.25 Å

PDB Description: the r state structure of e. coli atcase with atp and magnesium bound
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4kh0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kh0b2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d4kh0b2:

Click to download the PDB-style file with coordinates for d4kh0b2.
(The format of our PDB-style files is described here.)

Timeline for d4kh0b2: