Lineage for d4kh0c2 (4kh0 C:151-310)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156150Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2156151Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2156152Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2156153Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2156161Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
    Uniprot P00479
  8. 2156249Domain d4kh0c2: 4kh0 C:151-310 [229301]
    Other proteins in same PDB: d4kh0b1, d4kh0b2, d4kh0d1, d4kh0d2
    automated match to d3csua2
    complexed with atp, mg, pal, zn

Details for d4kh0c2

PDB Entry: 4kh0 (more details), 2.25 Å

PDB Description: the r state structure of e. coli atcase with atp and magnesium bound
PDB Compounds: (C:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d4kh0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kh0c2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOPe Domain Coordinates for d4kh0c2:

Click to download the PDB-style file with coordinates for d4kh0c2.
(The format of our PDB-style files is described here.)

Timeline for d4kh0c2: