| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
| Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
| Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) |
| Species Escherichia coli [TaxId:562] [53674] (62 PDB entries) Uniprot P00479 |
| Domain d4kh0c2: 4kh0 C:151-310 [229301] Other proteins in same PDB: d4kh0b1, d4kh0b2, d4kh0d1, d4kh0d2 automated match to d3csua2 complexed with atp, mg, pal, zn |
PDB Entry: 4kh0 (more details), 2.25 Å
SCOPe Domain Sequences for d4kh0c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kh0c2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl
Timeline for d4kh0c2: