SCOPe 2.06: Domain d4kh0d2: 4kh0 D:101-153

Lineage for d4kh0d2 (4kh0 D:101-153)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)

7. Species Escherichia coli [TaxId:562] [57828] (60 PDB entries)
   Uniprot P00478

8. Domain d4kh0d2: 4kh0 D:101-153 [229299]
   Other proteins in same PDB: d4kh0a1, d4kh0a2, d4kh0b1, d4kh0c1, d4kh0c2, d4kh0d1
   automated match to d2fzcb2
   complexed with atp, mg, pal, zn

Details for d4kh0d2

PDB Entry: 4kh0, 2.25 Å

PDB Description: the r state structure of e. coli atcase with atp and magnesium bound

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4kh0d2:

Sequence; same for both SEQRES and ATOM records:

>d4kh0d2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d4kh0d2:

• d4kh0d2 first appeared in SCOPe 2.03
  
• d4kh0d2 appears in SCOPe 2.05
  
• d4kh0d2 appears in SCOPe 2.07
  
• d4kh0d2 appears in the current release, SCOPe 2.08