SCOPe 2.04: Domain d4kh1c1: 4kh1 C:1-150

Lineage for d4kh1c1 (4kh1 C:1-150)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species)

7. Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
   Uniprot P00479

8. Domain d4kh1c1: 4kh1 C:1-150 [229294]
   Other proteins in same PDB: d4kh1b1, d4kh1b2, d4kh1d1, d4kh1d2
   automated match to d3csua1
   complexed with ctp, mg, pal, po4, utp, zn

Details for d4kh1c1

PDB Entry: 4kh1, 2.2 Å

PDB Description: The R state structure of E. coli ATCase with CTP,UTP, and Magnesium bound

PDB Compounds: (C:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d4kh1c1:

Sequence; same for both SEQRES and ATOM records:

>d4kh1c1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d4kh1c1:

• d4kh1c1 first appeared in SCOPe 2.03
  
• d4kh1c1 appears in SCOPe 2.05
  
• d4kh1c1 appears in the current release, SCOPe 2.08