| Class g: Small proteins [56992] (100 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) ![]() automatically mapped to Pfam PF02748 |
| Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein) |
| Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species) |
| Species Escherichia coli [TaxId:562] [57828] (62 PDB entries) Uniprot P00478 |
| Domain d4kh1d2: 4kh1 D:101-153 [229291] Other proteins in same PDB: d4kh1a1, d4kh1a2, d4kh1b1, d4kh1c1, d4kh1c2, d4kh1d1 automated match to d2fzcb2 complexed with ctp, mg, pal, po4, utp, zn |
PDB Entry: 4kh1 (more details), 2.2 Å
SCOPe Domain Sequences for d4kh1d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kh1d2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan
Timeline for d4kh1d2: