Lineage for d4kgxc1 (4kgx C:1-150)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2479956Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2479957Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2479958Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 protein domains)
  6. 2479959Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2479967Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
    Uniprot P00479
  8. 2480082Domain d4kgxc1: 4kgx C:1-150 [229284]
    Other proteins in same PDB: d4kgxb1, d4kgxb2, d4kgxd1, d4kgxd2
    automated match to d3csua1
    complexed with ctp, pal, zn

Details for d4kgxc1

PDB Entry: 4kgx (more details), 2.2 Å

PDB Description: the r state structure of e. coli atcase with ctp bound
PDB Compounds: (C:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d4kgxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kgxc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d4kgxc1:

Click to download the PDB-style file with coordinates for d4kgxc1.
(The format of our PDB-style files is described here.)

Timeline for d4kgxc1: