![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) ![]() automatically mapped to Pfam PF01948 |
![]() | Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase [54895] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [54896] (62 PDB entries) Uniprot P00478 |
![]() | Domain d4kgxd1: 4kgx D:11-100 [229281] Other proteins in same PDB: d4kgxa1, d4kgxa2, d4kgxb2, d4kgxc1, d4kgxc2, d4kgxd2 automated match to d2fzcb1 complexed with ctp, pal, zn |
PDB Entry: 4kgx (more details), 2.2 Å
SCOPe Domain Sequences for d4kgxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kgxd1 d.58.2.1 (D:11-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} aikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsedq vdqlalyapqatvnridnyevvgksrpslp
Timeline for d4kgxd1: